--- title: "Start - Load Sequences" canonical: "https://help.biobam.com/space/DOC/694808/Start%20-%20Load%20Sequences" format: markdown --- > Macro (toc) To start a new Blast2GO project you just have to load your sequence data from a file into Blast2GO. ## Load sequences from the start At the "File'' menu, go to **Load > Load Sequences > Load Fasta File** and select the file containing your sequences. The application accepts text files containing one or more DNA or protein sequences in FASTA or FASTQ format (see below). These files must have the extension *.fasta,.fnn,.faa,.fna,.ffn, .txt, .fq* or *.fastq* to be accepted by the application. A sequence in FASTA format begins with a single-line description or header starting with a ">'' character. The rest of the header line is arbitrary but should be informative. Subsequent lines contain the sequence, one character per residue. Lines can have different lengths. Be sure your file is in this format and avoid strange characters in the sequence header, such as '&' or '\' and use 'N' to denote in-determinations in the sequences. An example of the FASTA format: > ℹ️ ^{>gi|121664|sp|P00435|GSHC BOVIN GLUTATHIONE PEROXIDASE MCAAQRSAAALAAAAPRTVYAFSARPLAGGEPFNLSSLRGKVLLIENVASLUGTTVRDYTQMNDLQRLGPRGLVVLGFPCNQFGHQENAKNEEILNCLKYVRPGGGF} ## Show Sequence Once the sequences have been loaded to Blast2GO, it is possible to see them by right-clicking on the Sequence Table. The "Single Sequence Menu'' (context menu) will appear (Figure [1](/wiki/pages/resumedraft.action?draftId=694808#Sequences-figure1)). This menu provides some functions for sequences individually, i.e. will apply to the sequence at that position of the Table. ### Export FASTA Sequence with Annotation Results After executing the whole functional annotation of the sequences in Blast2GO (BLAST, Mapping and Annotation) it is possible to export the sequence in FASTA format with the corresponding sequence description and GO ID or GO term. An example of the Exported FASTA format with Sequence Description and GO IDs: > ℹ️ ^{>C04018C10|mitogen-activated protein kinase 3|GO:0005634;GO:0004707;GO:0005515} > ℹ️ ^{acaaacgagagcgtagaaaattaattagagagaaaaagagagagagtaaaatggctgacgtggcgcaggtcaacg} > ℹ️ ^{gcgtaggtcaaacggctgattttcctgcggtaccgacgcacggcggtcagtttatacagtacaatatatttggaa} > ℹ️ ^{acttgtttgaaatcacggccaagtatcggcctccgatcatgccgattggtcgcggcgcgtacgggatcgtttgct} > ℹ️ ^{cggtgttgaatacggagacgaatgagctcgttgcgatgaagaaaatagcgaacgcttttgataatcacatggatg} > ℹ️ ^{ccaagcgaacgcttcgtgagattaagcttctgcaacatttcgatcatgaaaatgtgatagctgtaaaagatgtgg} > ℹ️ ^{ttcccccaccgttacgaagagaattcactgatgtctatattgctgcggaactcatggacactgacctttaccaaa} > ℹ️ ^{ttattcgctcaaatcaaagtttatccgaggagcactgccagtatttcttgtatcaacttcttcgaggactcaagt} > ℹ️ ^{atatccattcagcaaatgttattcatcgggatttgaagcccagcaatctcttgttaaatgcaaattgtgatttaa} > ℹ️ ^{aaatttgtgattttggtcttgctcgtccaacctcggagaatgagttcatgacagagtatgttgtcacaagatggt} > ℹ️ ^{accgagcccctgagttgttattgaactcatctgactacactg}